Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) antibody

Antigen: Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2)

Synonyms: KAT4, KATIV, mitAAT, FLJ40994, got2, GOT2, DKFZp459L1636

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310472

Additional Information

Alternative name: GOT2

Gene ID: GOT2

UniProt: P00505

Immunogen: The immunogen for anti-GOT2 antibody: synthetic peptide directed towards the N terminal of human GOT2

Sequence: PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPS VRKAEAQIAA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-GOT2 antibody concentration is 1 mg/ml.

Description: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Characteristics: Antigen Size: 430 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-GOT2 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Metabolism, Amino Acids

Restrictions: For Research Use only

Images

WB Suggested Anti-GOT2 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).