Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2) antibody

Antigen: Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN310517

Additional Information

Alternative name: SLCO1A2 / OATP1

Gene ID: SLCO1A2

UniProt: P46721-2

Immunogen: The immunogen for anti-SLCO1A2 antibody: synthetic peptide directed towards the middle region of human SLCO1A2

Sequence: AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWV GAWWFGFLIC

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SLCO1A2 antibody concentration is 1 mg/ml.

Description: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.

Characteristics: Antigen Size: 579 amino acids

Molecular Weight: 64kDa

Application Details

Application Notes: WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Lee, Glaeser, Smith et al.: "Polymorphisms in human organic anion-transporting polypeptide 1A2 (OATP1A2): implications for altered drug disposition and central nervous system drug entry." in: The Journal of biological chemistry, Vol. 280, Issue 10, pp. 9610-7, 2005 (PubMed).