Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 35, Member B1 (SLC35B1) (C-Term) antibody

Details for Product No. ABIN310520
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UGTREL1, Ugalt2, UGTrel1, ERNST, UGALT2, ERNST1, zgc:92284, wu:fj99g11, slc35b1, MGC53978, ernst1
Epitope
C-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310520
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SLC35B1
Sequence ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFAN PISPMQWVGT
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against SLC35B1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SLC35B1
Background SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.
Molecular Weight 35 kDa
Gene ID 10237
NCBI Accession NM_005827, NP_005818
UniProt P78383
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 322 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 35, Member B1 (SLC35B1) (C-Term) antibody WB Suggested Anti-SLC35B1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Background publications Ishida, Miura, Yoshioka et al.: "Molecular cloning and characterization of a novel isoform of the human UDP-galactose transporter, and of related complementary DNAs belonging to the nucleotide-sugar transporter gene family." in: Journal of biochemistry, Vol. 120, Issue 6, pp. 1074-8, 1997 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310520
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top