Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310520

Solute Carrier Family 35, Member B1 (SLC35B1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UGTREL1, Ugalt2, UGTrel1, ERNST, UGALT2, ERNST1, zgc:92284, wu:fj99g11, slc35b1, MGC53978, ernst1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310520
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC35B1 antibody: synthetic peptide directed towards the C terminal of human SLC35B1
Sequence ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFAN PISPMQWVGT
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against SLC35B1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SLC35B1
Background SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.
Molecular Weight 35kDa
Gene ID 10237
NCBI Accession NP_005818, NM_005827
UniProt P78383
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC35B1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ishida, Miura, Yoshioka et al.: "Molecular cloning and characterization of a novel isoform of the human UDP-galactose transporter, and of related complementary DNAs belonging to the nucleotide-sugar transporter gene family." in: Journal of biochemistry, Vol. 120, Issue 6, pp. 1074-8, 1997 (PubMed).

Alternatives for antigen "Solute Carrier Family 35, Member B1 (SLC35B1)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Beacon