Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 35, Member F5 (SLC35F5) (C-Term) antibody

Details for Product No. ABIN310540
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300003P13Rik, AI646727
Epitope
C-Term
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(3)
Host
Rabbit
(2), (2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (2), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310540
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SLC35F5
Sequence VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFE FPNKVVLMCI
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against SLC35F5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SLC35F5
Background SLC35F5 is a putative solute transporter.
Molecular Weight 59 kDa
Gene ID 80255
NCBI Accession NM_025181, NP_079457
UniProt Q8WV83
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 523 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Hosts (2), (2), (1)
Reactivities (3)
Applications (3), (2), (1)
Epitopes (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310540
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top