Solute Carrier Family 25, Member 46 (SLC25A46) antibody

Antigen: Solute Carrier Family 25, Member 46 (SLC25A46)

Synonyms: AI325987, 1200007B05Rik, RGD1305072, zgc:92767, SLC25A46, MGC152354

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN310551

Additional Information

Alternative name: SLC25A46 / TB1

Gene ID: SLC25A46

UniProt: Q96AG3

Immunogen: The immunogen for anti-SLC25A46 antibody: synthetic peptide directed towards the N terminal of human SLC25A46

Sequence: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTS TPYEGPTEEP

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SLC25A46 antibody concentration is 1 mg/ml.

Description: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Characteristics: Antigen Size: 418 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-SLC25A46 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC25A46 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Nishisho, Nakamura, Miyoshi et al.: "Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients." in: Science (New York, N.Y.), Vol. 253, Issue 5020, pp. 665-9, 1991 (PubMed).