Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1) antibody

Antigen: Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1)

Synonyms: LOC100226745

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310565

Additional Information

Alternative name: SLC19A1 / FLOT1

Gene ID: SLC19A1

UniProt: P41440

Immunogen: The immunogen for anti-SLC19A1 antibody: synthetic peptide directed towards the N terminal of human SLC19A1

Sequence: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQ IRPGESFITP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SLC19A1 antibody concentration is 1 mg/ml.

Description: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].

Characteristics: Antigen Size: 591 amino acids

Molecular Weight: 65kDa

Application Details

Application Notes: WB Suggested Anti-SLC19A1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC19A1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

anti-Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1) antibody (Image 2)

Publications

Product: Payton, Liu, Ge et al.: "Transcriptional regulation of the human reduced folate carrier A1/A2 promoter: Identification of critical roles for the USF and GATA families of transcription factors." in: Biochimica et biophysica acta, Vol. 1731, Issue 2, pp. 115-24, 2005 (PubMed).