Sonic Hedgehog (SHH) antibody

Antigen: Sonic Hedgehog (SHH)

Synonyms: TPT, HHG1, HLP3, HPE3, SMMCI, TPTPS, MCOPCB5, Hx, Dsh, Hhg1, Hxl3, M100081, 9530036O11Rik, shh, syu, vhh1, wu:fc83d08, SHH

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Zebrafish, Rat (Rattus), Chicken, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310574

Additional Information

Gene ID: SHH

UniProt: Q15465

Immunogen: The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH

Sequence: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYK QFIPNVAEKT

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SHH antibody concentration is 1 mg/ml.

Description: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved, the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Characteristics: Antigen Size: 462 amino acids

Molecular Weight: 28kDa

Application Details

Application Notes: WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Immunohistochemistry Sample Type: Chicken Embryos. Dilution: 1:1000.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Sample Type: Chicken EmbryosDilution: 1:1000

Publications

Product: Coon, Roberts, Loscertales et al.: "Differential epithelial expression of SHH and FOXF1 in usual and nonspecific interstitial pneumonia." in: Experimental and molecular pathology, Vol. 80, Issue 2, pp. 119-23, 2006 (PubMed).