Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310590

Colony Stimulating Factor 1 (Macrophage) (CSF1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CSF-1, MCSF, C87615, Csfm, op, CSF1, csf1-1, zgc:172186
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310590
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1
Sequence PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQS LQRLIDSQME
Predicted Reactivity Human : 100%, Rabbit : 92%, Dog : 84%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against CSF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CSF1
Background CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene.
Molecular Weight 45kDa
Gene ID 1435
NCBI Accession NP_757349, NM_172210
UniProt Q5VVF3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CSF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications West, Rubin, Miller et al.: "A landscape effect in tenosynovial giant-cell tumor from activation of CSF1 expression by a translocation in a minority of tumor cells." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 3, pp. 690-5, 2006 (PubMed).

Alternatives for antigen "Colony Stimulating Factor 1 (Macrophage) (CSF1)", type "Antibodies"
Hosts (69), (21), (7), (2)
Reactivities (84), (42), (30), (18), (18), (17), (1), (1), (1)
Applications (68), (54), (20), (20), (19), (9), (7), (3), (2), (2), (1), (1), (1)
Conjugates (11), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon