Colony Stimulating Factor 1 (Macrophage) (CSF1) antibody

Antigen: Colony Stimulating Factor 1 (Macrophage) (CSF1)

Synonyms: MCSF, MGC31930, op, Csfm, CSF-1, M-CSF, C87615, CSF1, csf1-1, zgc:172186

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310590

Additional Information

Alternative name: Macrophage Colony Stimulating Factor (M-CSF)

Gene ID: CSF1

UniProt: Q5VVF3

Immunogen: The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1

Sequence: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQS LQRLIDSQME

Cross-Reactivity: Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CSF1 antibody concentration is 1 mg/ml.

Description: CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene.

Characteristics: Antigen Size: 438 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cytokines

Restrictions: For Research Use only

Images

WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: West, Rubin, Miller et al.: "A landscape effect in tenosynovial giant-cell tumor from activation of CSF1 expression by a translocation in a minority of tumor cells." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 3, pp. 690-5, 2006 (PubMed).