Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Podoplanin (PDPN) antibody

Antigen

Podoplanin (PDPN)

Synonyms T1A, GP36, GP40, Gp38, OTS8, T1A-2, AGGRUS, HT1A-1, PA2.26, T1a, OTS-8, T1alpha, RANDAM-2, E11, RTI40, T1-alpha, PDPN
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN310607
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Podoplanin
Gene ID PDPN
UniProt A1A5S2
Immunogen The immunogen for anti-PDPN antibody: synthetic peptide directed towards the N terminal of human PDPN
Sequence EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY KSGLTTLVAT
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PDPN antibody concentration is 1 mg/ml.
Description PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
Characteristics Antigen Size: 238 amino acids
Molecular Weight 25kDa

Application Details

Application Notes WB Suggested Anti-PDPN Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Wicki, Lehembre, Wick et al.: "Tumor invasion in the absence of epithelial-mesenchymal transition: podoplanin-mediated remodeling of the actin cytoskeleton." in: Cancer cell, Vol. 9, Issue 4, pp. 261-72, 2006 (PubMed).