Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) antibody

Antigen: Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1)

Synonyms: KIAA1754L

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN310610

Additional Information

Alternative name: ITPRIPL1 / KIAA1754L

Gene ID: KIAA1754L

UniProt: Q6GPH6

Immunogen: The immunogen for anti-KIAA1754L antibody: synthetic peptide directed towards the C terminal of human KIAA1754L

Sequence: EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASR PILTSYHFKT

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KIAA1754L antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 555 amino acids

Molecular Weight: 61kDa

Application Details

Application Notes: WB Suggested Anti-KIAA1754L Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KIAA1754L Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).