Retinoic Acid Receptor, beta (RARB) antibody

Antigen: Retinoic Acid Receptor, beta (RARB)

Synonyms: HAP, RRB2, NR1B2, RXR-beta, RARBETA, RARB, nRARs

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310689

Additional Information

Alternative name: RAR-beta / RARB

Gene ID: RARB

UniProt: P10826

Immunogen: The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB

Sequence: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS SGNTAEHSPS

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RARB antibody concentration is 1 mg/ml.

Description: RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants, one additional transcript has been described, but its full length nature has not been determined.

Characteristics: Antigen Size: 448 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.
IHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 5 ug/ml.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

IHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 5 ug/ml.

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).