Protein O-Fucosyltransferase 2 (POFUT2) antibody

Antigen: Protein O-Fucosyltransferase 2 (POFUT2)

Synonyms: FUT13, C21orf80

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN310738

Additional Information

Alternative name: POFUT2

Gene ID: POFUT2

UniProt: Q9Y2G5

Immunogen: The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the N terminal of human POFUT2

Sequence: GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTE EWVLVLPPWG

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-POFUT2 antibody concentration is 1 mg/ml.

Description: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF, MIM 131530)-like repeats or thrombospondin (THBS, see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).[supplied by OMIM].

Characteristics: Antigen Size: 429 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-POFUT2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-POFUT2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Luo, Koles, Vorndam et al.: "Protein O-fucosyltransferase 2 adds O-fucose to thrombospondin type 1 repeats." in: The Journal of biological chemistry, Vol. 281, Issue 14, pp. 9393-9, 2006 (PubMed).

Luo, Nita-Lazar, Haltiwanger: "Two distinct pathways for O-fucosylation of epidermal growth factor-like or thrombospondin type 1 repeats." in: The Journal of biological chemistry, Vol. 281, Issue 14, pp. 9385-92, 2006 (PubMed).