Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Salt-Inducible Kinase 1 (SIK1) antibody

Antigen

Salt-Inducible Kinase 1 (SIK1)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN310741
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SIK1
Gene ID SNF1LK
UniProt P57059
Immunogen The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK
Sequence MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAV VKLARHRVTK
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-SNF1LK antibody concentration is 1 mg/ml.
Description SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
Characteristics Antigen Size: 783 amino acids
Molecular Weight 85kDa

Application Details

Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Nishimura, Hayashi, Inada et al.: "Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins." in: Biochemical and biophysical research communications, Vol. 254, Issue 1, pp. 21-6, 1999 (PubMed).

Alternatives

Alternatives for antigen "Salt-Inducible Kinase 1 (SIK1)", type "Antibodies"
Hosts Rabbit (39), Mouse (2)
Reactivities Human (37), Mouse (Murine) (23), Rat (Rattus) (22), Dog (Canine) (18), Horse (Equine) (18), Pig (Porcine) (18)
Applications Western Blotting (WB) (22), ELISA (18), Immunofluorescence (IF) (18), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (IHC) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), Internal Region (2), AA 1-783 (1), Center (1), Middle Region (1), N-Term (1)