Peroxisomal Biogenesis Factor 3 (PEX3) antibody

Antigen: Peroxisomal Biogenesis Factor 3 (PEX3)

Synonyms: TRG18, FLJ13531, DKFZp686N14184

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310767

Additional Information

Alternative name: Peroxin 3 / PEX3

Gene ID: PEX3

UniProt: P56589

Immunogen: The immunogen for anti-PEX3 antibody: synthetic peptide directed towards the N terminal of human PEX3

Sequence: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVL SMLPTLREAL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PEX3 antibody concentration is 1 mg/ml.

Description: PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Characteristics: Antigen Size: 373 amino acids

Molecular Weight: 42kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Peroxisomal Biogenesis Factor 3 (PEX3) antibody

anti-Peroxisomal Biogenesis Factor 3 (PEX3) antibody (Image 2)

Publications

Product: Fang, Morrell, Jones et al.: "PEX3 functions as a PEX19 docking factor in the import of class I peroxisomal membrane proteins." in: The Journal of cell biology, Vol. 164, Issue 6, pp. 863-75, 2004 (PubMed).