Peptidylprolyl Isomerase F (PPIF) antibody

Antigen: Peptidylprolyl Isomerase F (PPIF)

Synonyms: CYP3, Cyp-D, FLJ90798, MGC117207, CypD, CyP-D, CyP-F, PPIase, AW457192, MGC93084, PPIF, wu:fd61c06, zgc:101753, MGC79544

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Dog (Canine), Mouse (Murine), Xenopus laevis, Chicken, Rabbit

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310779

Additional Information

Alternative name: Cyclophilin F

Gene ID: PPIF

UniProt: P30405

Immunogen: The immunogen for anti-PPIF antibody: synthetic peptide directed towards the middle region of human PPIF

Sequence: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFT LKHVGPGVLS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PPIF antibody concentration is 1 mg/ml.

Description: PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Characteristics: Antigen Size: 207 amino acids

Molecular Weight: 19kDa

Application Details

Application Notes: WB Suggested Anti-PPIF Antibody Titration: 5.0ug/ml
Positive Control: 721_B cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Apoptosis/Necrosis

Restrictions: For Research Use only

Images

WB Suggested Anti-PPIF Antibody Titration: 5.0ug/ml
Positive Control: 721_B cell lysate

Publications

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).