Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310784

Interferon-Induced Protein 44-Like (IFI44L) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf29, H-28, H28, H28-1, NS1178, IFI44L
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310784
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IFI44L antibody: synthetic peptide directed towards the N terminal of human IFI44L
Sequence MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDM VERCSRQGCT
Predicted Reactivity Human : 92%
Characteristics This is a rabbit polyclonal antibody against IFI44L. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name IFI44L
Background The function remains known.
Molecular Weight 47kDa
Gene ID 10964
NCBI Accession NP_006811, NM_006820
UniProt Q99984
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IFI44L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Interferon-Induced Protein 44-Like (IFI44L)", type "Antibodies"
Hosts (6), (1)
Reactivities (6)
Applications (6), (2), (2), (1)
Epitopes (3), (2), (1), (1), (1)
Beacon