ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae) (ASF1B) antibody

Antigen: ASF1 Anti-Silencing Function 1 Homolog B (S. Cerevisiae) (ASF1B)

Synonyms: CIA-II, FLJ10604, AA409591, 1700003K02Rik, fc68a10, zgc:77178, wu:fc68a10, ASF1B, MGC139875, ANTI- SILENCING FUNCTION 1B, F16F17.110, F16F17_110, SGA01, SGA1, asf1, MGC89345

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Chicken, Rabbit, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN310800

Additional Information

Alternative name: ASF1B

Gene ID: ASF1B

UniProt: Q9NVP2

Immunogen: The immunogen for anti-ASF1B antibody: synthetic peptide directed towards the middle region of human ASF1B

Sequence: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL ASNPRVTRFH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ASF1B antibody concentration is 1 mg/ml.

Description: ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Characteristics: Antigen Size: 202 amino acids

Molecular Weight: 22kDa

Application Details

Application Notes: WB Suggested Anti-ASF1B Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ASF1B Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).