ASF1B antibody

Catalog No. ABIN630638

The Rabbit Polyclonal anti-ASF1B antibody is suitable to detect ASF1B in samples from Human, Mouse, Rat and Dog. It has been validated for WB.

Quick Overview for ASF1B antibody (ABIN630638)

Target: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASF1B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASF1B Antibody

Purification: Affinity purified

Immunogen: ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASF1B Blocking Peptide, (ABIN936087), is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASF1B

Target: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Alternative Name: ASF1B

Background: ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Regulation of Cell Size