ASF1B antibody

Catalog No. ABIN630638

Product Details anti-ASF1B Antibody

Target: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASF1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASF1B Blocking Peptide, catalog no. 33R-10123, is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASF1B

Target: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Alternative Name: ASF1B (ASF1B Products)

Synonyms: CIA-II antibody, asf1-b antibody, asf1a antibody, asf1a-b antibody, asf1ab antibody, cia-ii antibody, 1700003K02Rik antibody, AA409591 antibody, asf1b antibody, fc68a10 antibody, wu:fc68a10 antibody, zgc:77178 antibody, ASF1B antibody, F16F17.110 antibody, F16F17_110 antibody, SGA01 antibody, SGA1 antibody, anti- silencing function 1b antibody, asf1 antibody, MGC89345 antibody, asb1bb antibody, wu:fb20g03 antibody, zgc:76977 antibody, anti-silencing function 1B histone chaperone antibody, anti-silencing function 1B histone chaperone L homeolog antibody, anti-silencing function 1Ba histone chaperone antibody, anti- silencing function 1b antibody, histone chaperone ASF1B antibody, anti-silencing function 1Bb histone chaperone antibody, ASF1B antibody, asf1b.L antibody, Asf1b antibody, asf1ba antibody, LOC9304878 antibody, asf1b antibody, asf1bb antibody

Background: ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Regulation of Cell Size