Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310802

GINS Complex Subunit 1 (Psf1 Homolog) (GINS1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PSF1, 2810418N01Rik, Gins4, mKIAA0186, GINS1, RGD1562246, zgc:101672, psf1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310802
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GINS1 antibody: synthetic peptide directed towards the N terminal of human GINS1
Sequence MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALY EQNQSDVNEA
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%, Zebrafish : 92%, African clawed frog : 85%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against GINS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name GINS1
Background The GINS complex plays an essential role in the initiation of DNA replication.
Molecular Weight 23kDa
Gene ID 9837
NCBI Accession NP_066545, NM_021067
UniProt Q14691
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GINS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ueno, Itoh, Kong et al.: "PSF1 is essential for early embryogenesis in mice." in: Molecular and cellular biology, Vol. 25, Issue 23, pp. 10528-32, 2005 (PubMed).

Alternatives for antigen "GINS Complex Subunit 1 (Psf1 Homolog) (GINS1)", type "Antibodies"
Hosts (7), (2)
Reactivities (8)
Applications (8), (2), (2), (1)
Epitopes (5), (2), (2), (2)
Beacon