Mitochondrial Ribosomal Protein S12 (MRPS12) antibody

Antigen: Mitochondrial Ribosomal Protein S12 (MRPS12)

Synonyms: RPS12, RPMS12, RPSM12, MPR-S12, MT-RPS12, rps12, Rpms12, AI327385, CG7925, DmelCG7925, EG:BACH59J11.1, l(1)3Ab, l(1)tko, MRP-S12, mRpS12, MRPS12, mt-rps12, S12, MGC2616, MRP-S34, MGC64304, GB10531, MGC137645, DKFZp470C244

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310803

Additional Information

Alternative name: MRPS12

Gene ID: MRPS12

UniProt: O15235

Immunogen: The immunogen for anti-MRPS12 antibody: synthetic peptide directed towards the N terminal of human MRPS12

Sequence: LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLK GVVLCTFTRK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MRPS12 antibody concentration is 1 mg/ml.

Description: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene, all three variants encode the same protein.

Characteristics: Antigen Size: 138 amino acids

Molecular Weight: 12kDa

Synonyms: RPS12, RPMS12, RPSM12, MPR-S12, MT-RPS12, rps12, Rpms12, AI327385, CG7925, DmelCG7925, EG:BACH59J11.1, l(1)3Ab, l(1)tko, MRP-S12, mRpS12, MRPS12, mt-rps12, S12, MGC2616, MRP-S34, MGC64304, GB10531, MGC137645, DKFZp470C244

Application Details

Application Notes: WB Suggested Anti-MRPS12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MRPS12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).