Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310805

phosphopantothenoylcysteine Decarboxylase (PPCDC) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1810057I13Rik, 8430432M10Rik, RGD1306267, MDS018
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310805
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PPCDC antibody: synthetic peptide directed towards the N terminal of human PPCDC
Sequence VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHID LRRWADLLLV
Predicted Reactivity Dog : 100%, Guinea pig : 92%, Rat : 92%, Bovine : 85%, Chicken : 85%, Horse : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against PPCDC. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PPCDC
Background Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.
Molecular Weight 22kDa
Gene ID 60490
NCBI Accession NP_068595, NM_021823
UniProt Q96CD2
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PPCDC antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Daugherty, Polanuyer, Farrell et al.: "Complete reconstitution of the human coenzyme A biosynthetic pathway via comparative genomics." in: The Journal of biological chemistry, Vol. 277, Issue 24, pp. 21431-9, 2002 (PubMed).

Alternatives for antigen "phosphopantothenoylcysteine Decarboxylase (PPCDC)", type "Antibodies"
Hosts (5), (2)
Reactivities (4), (3)
Applications (7), (2), (1)
Epitopes (4), (2), (2), (1)
Beacon