Did you know that you can buy products from over 140 different suppliers from us?

phosphopantothenoylcysteine Decarboxylase (PPCDC) (N-Term) antibody

Details for Product No. ABIN310805
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDS018, 1810057I13Rik, 8430432M10Rik, RGD1306267
Epitope
N-Term
(7), (7), (2)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(6), (5)
Host
Rabbit
(10), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (7), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310805
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PPCDC
Sequence VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHID LRRWADLLLV
Predicted Reactivity Dog : 100 %, Guinea pig : 90 %, Rat : 90 %, Bovine : 80 %, Chicken : 80 %, Horse : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against PPCDC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PPCDC
Background Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.
Molecular Weight 22 kDa
Gene ID 60490
NCBI Accession NM_021823, NP_068595
UniProt Q96CD2
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 204 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-phosphopantothenoylcysteine Decarboxylase (PPCDC) (N-Term) antibody WB Suggested Anti-PPCDC Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Daugherty, Polanuyer, Farrell et al.: "Complete reconstitution of the human coenzyme A biosynthetic pathway via comparative genomics." in: The Journal of biological chemistry, Vol. 277, Issue 24, pp. 21431-9, 2002 (PubMed).

Validation Images
back to top