Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310808

DCTP Pyrophosphatase 1 (DCTPP1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RS21C6, XTP3TPA, RS21-C6, AI854235, 2410015N17Rik, Rs21c6, Xtp3tpa, xtp3tpa
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310808
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-XTP3TPA antibody: synthetic peptide directed towards the middle region of human XTP3TPA
Sequence KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADI PCDSTGQTST
Predicted Reactivity Human :100%,   Dog :78%,   Bovine :78%,  
Characteristics This is a rabbit polyclonal antibody against XTP3TPA. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name XTP3TPA
Background The function remains unknown.
Molecular Weight 19kDa
Gene ID 79077
NCBI Accession NP_077001, NM_024096
UniProt Q9H773
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-XTP3TPA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "DCTP Pyrophosphatase 1 (DCTPP1)", type "Antibodies"
Hosts (11), (1)
Reactivities (10)
Applications (11), (4), (4), (3), (1)
Epitopes (7), (2), (1), (1)
Beacon