DCTP Pyrophosphatase 1 (DCTPP1) (Middle Region) antibody

Details for Product No. ABIN310808
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RS21C6, XTP3TPA, RS21-C6, AI854235, 2410015N17Rik, Rs21c6, Xtp3tpa, xtp3tpa
Epitope
Middle Region
(7), (2), (1), (1)
Reactivity
Dog (Canine), Cow (Bovine), Human
(11)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(11), (5), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN310808
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human XTP3TPA
Sequence KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADI PCDSTGQTST
Predicted Reactivity Human :100 %,   Dog :70 %,   Bovine :70 %,  
Characteristics This is a rabbit polyclonal antibody against XTP3TPA. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name XTP3TPA
Background The function remains unknown.
Molecular Weight 19 kDa
Gene ID 79077
NCBI Accession NM_024096, NP_077001
UniProt Q9H773
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 170 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DCTP Pyrophosphatase 1 (DCTPP1) (Middle Region) antibody WB Suggested Anti-XTP3TPA Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (12), (1)
Reactivities (11)
Applications (11), (5), (3), (3), (1)
Epitopes (7), (2), (1), (1)
back to top