DCTP Pyrophosphatase 1 (DCTPP1) antibody

Antigen: DCTP Pyrophosphatase 1 (DCTPP1)

Synonyms: CDA03, RS21C6, MGC5627, XTP3TPA, RS21-C6, AI854235, 2410015N17Rik, Rs21c6, Xtp3tpa, xtp3tpa, MGC80796, MGC89294, MGC133613

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310808

Additional Information

Alternative name: XTP3TPA / DCTPP1

Gene ID: XTP3TPA

UniProt: Q9H773

Immunogen: The immunogen for anti-XTP3TPA antibody: synthetic peptide directed towards the middle region of human XTP3TPA

Sequence: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADI PCDSTGQTST

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-XTP3TPA antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 170 amino acids

Molecular Weight: 19kDa

Application Details

Application Notes: WB Suggested Anti-XTP3TPA Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-XTP3TPA Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

anti-DCTP Pyrophosphatase 1 (DCTPP1) antibody (Image 2)

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).