Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3) antibody

Antigen: Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3)

Synonyms: P24B, C15orf22, MGC133022, MGC94283, wu:fb09b11

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN310861

Additional Information

Alternative name: TMED3

Gene ID: TMED3

UniProt: Q9Y3Q3

Immunogen: The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3

Sequence: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTE KRPISRAVHS

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TMED3 antibody concentration is 1 mg/ml.

Description: The function remains known.

Characteristics: Antigen Size: 217 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-TMED3 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMED3 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).