Protein tyrosine Phosphatase-Like A Domain Containing 1 (PTPLAD1) antibody

Antigen: Protein tyrosine Phosphatase-Like A Domain Containing 1 (PTPLAD1)

Synonyms: B-IND1, HSPC121, FLJ90376, B-ind1, Hspc121, AW742319, MGC25483, 4930523M17Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310895

Additional Information

Alternative name: PTPLAD1 / BIND1

Gene ID: PTPLAD1

Immunogen: The immunogen for anti-PTPLAD1 antibody: synthetic peptide directed towards the N terminal of human PTPLAD1

Sequence: WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY LFMYNLVQFL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PTPLAD1 antibody concentration is 1 mg/ml.

Description: PTPLAD1 is a multi-pass membrane protein. It belongs to the PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading to the modulation of gene expression.

Characteristics: Antigen Size: 362 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-PTPLAD1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PTPLAD1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Publications

Product: Taguwa, Okamoto, Abe et al.: "Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication." in: Journal of virology, Vol. 82, Issue 6, pp. 2631-41, 2008 (PubMed).