Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Alanine-Glyoxylate Aminotransferase 2-Like 2 (AGXT2L2) antibody

Antigen

Alanine-Glyoxylate Aminotransferase 2-Like 2 (AGXT2L2)
Synonyms RP23-79E13.3, 2900006B13Rik, MGC15875, MGC45484, MGC117348, AGXT2L2, Agxt2l2, MGC188042
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310939
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Alanine-Glyoxylate Aminotransferase 2-Like 2 (AGXT2L2) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name AGXT2L2
Gene ID AGXT2L2
Immunogen The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the C terminal of human AGXT2L2
Sequence KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVS RLKENYVLLS
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-AGXT2L2 antibody concentration is 1 mg/ml.
Description The function remains unknown.
Characteristics Antigen Size: 450 amino acids
Molecular Weight 50kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-AGXT2L2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Alanine-Glyoxylate Aminotransferase 2-Like 2 (AGXT2L2)", type "Antibodies"
Hosts Rabbit (31)
Reactivities Human (31), Mouse (Murine) (25), Rat (Rattus) (24), Cow (Bovine) (21), Dog (Canine) (19), Cat (Feline) (1), Chicken (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (15), ELISA (12), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (2), N-Term (1)