Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Nanog Homeobox (NANOG) antibody

Antigen

Nanog Homeobox (NANOG)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310961
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NANOG
Gene ID NANOG
UniProt Q9H9S0
Immunogen The immunogen for anti-NANOG antibody: synthetic peptide directed towards the N terminal of human NANOG
Sequence ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDL LIQDSPDSST
Cross-Reactivity Cow (Bovine), Human, Pig (Porcine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NANOG antibody concentration is 1 mg/ml.
Description NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
Characteristics Antigen Size: 305 amino acids
Molecular Weight 33kDa

Application Details

Application Notes WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Piestun, Kochupurakkal, Jacob-Hirsch et al.: "Nanog transforms NIH3T3 cells and targets cell-type restricted genes." in: Biochemical and biophysical research communications, Vol. 343, Issue 1, pp. 279-85, 2006 (PubMed).

Alternatives

Alternatives for antigen "Nanog Homeobox (NANOG)", type "Antibodies"
Hosts Rabbit (78), Mouse (21), Goat (9)
Reactivities Human (102), Mouse (Murine) (31), Rat (Rattus) (22), Dog (Canine) (2), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Goat (1), Monkey (1), Pig (Porcine) (1)
Applications Western Blotting (WB) (87), ELISA (63), Immunofluorescence (IF) (35), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (17), Immunohistochemistry (IHC) (12), Immunocytochemistry (ICC) (7), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (2), Blocking Antibody (Inhibition) (1), Enzyme Immunoassay (EIA) (1), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (6), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (6), N-Term (6), C-Term (5), AA 1-154 (3), AA 1-50 (2), AA 20-166 (2), Ser285 (2), Center (1), Middle Region (1), pSer285 (1), pSer71 (1)