Malate Dehydrogenase 1, NAD (Soluble) (MDH1) antibody

Antigen: Malate Dehydrogenase 1, NAD (Soluble) (MDH1)

Synonyms: MDHA, MOR2, MDH-s, MGC:1375, Mor2, Mor-2, D17921, B230377B03Rik, MDL1, Mdhl, MDH, MGC68659, MDH-1, Mdh, Mdh-1, Mdh2, MdhD, cMdh, sMdh

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Arabidopsis, Pig (Porcine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311017

Additional Information

Alternative name: MDHA

Gene ID: MDH1

UniProt: P40925

Immunogen: The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1

Sequence: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSST QYPDVNHAKV

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MDH1 antibody concentration is 1 mg/ml.

Description: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 334 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-MDH1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MDH1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).