Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 1 Open Reading Frame 63 (C1orf63) antibody

Antigen

Chromosome 1 Open Reading Frame 63 (C1orf63)

Synonyms NPD014, DJ465N24.2.1, RP3-465N24.4, DKFZp469M2120
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311029
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C1orf63
Gene ID C1orf63
UniProt Q9BUV0
Immunogen The immunogen for anti-C1orf63 antibody: synthetic peptide directed towards the C terminal of human C1orf63
Sequence PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQK KSPYGLWIPI
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C1orf63 antibody concentration is 1 mg/ml.
Description The exact function of C1orf63 remains unknown.
Characteristics Antigen Size: 290 amino acids
Molecular Weight 33kDa

Application Details

Application Notes WB Suggested Anti-C1orf63 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 1 Open Reading Frame 63 (C1orf63)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (3)