Tetratricopeptide Repeat Domain 6 (TTC6) antibody

Antigen: Tetratricopeptide Repeat Domain 6 (TTC6)

Synonyms: MGC119358, MGC119360, MGC119361

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN311044

Additional Information

Alternative name: TTC6

Gene ID: TTC6

UniProt: Q86TZ1

Immunogen: The immunogen for anti-TTC6 antibody: synthetic peptide directed towards the C terminal of human TTC6

Sequence: MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSK ALKFDPENEY

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TTC6 antibody concentration is 1 mg/ml.

Description: The functions of TTC6 remain unknown.

Characteristics: Antigen Size: 520 amino acids

Molecular Weight: 59kDa

Application Details

Application Notes: WB Suggested Anti-TTC6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TTC6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).