tRNA Methyltransferase 11 Homolog (S. Cerevisiae) (Trmt11) antibody

Antigen: tRNA Methyltransferase 11 Homolog (S. Cerevisiae) (Trmt11)

Synonyms: AW213713, 2410075D05Rik, 3110045I18Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311050

Additional Information

Alternative name: TRMT11 / C6orf75

Gene ID: TRMT11

UniProt: Q7Z4G4

Immunogen: The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11

Sequence: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVF SVLEDYGLDP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRMT11 antibody concentration is 1 mg/ml.

Description: TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Characteristics: Antigen Size: 463 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-TRMT11 Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRMT11 Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate

Publications

Product: Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).