Methyltransferase Like 1 (METTL1) antibody

Antigen: Methyltransferase Like 1 (METTL1)

Synonyms: TRM8, C12orf1, YDL201w, FLJ95748

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN311061

Additional Information

Alternative name: METTL1

Gene ID: METTL1

Immunogen: The immunogen for anti-METTL1 antibody: synthetic peptide directed towards the middle region of human METTL1

Sequence: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRV GGLVYTITDV

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-METTL1 antibody concentration is 1 mg/ml.

Description: METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.

Characteristics: Antigen Size: 301 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-METTL1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-METTL1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Cartlidge, Knebel, Peggie et al.: "The tRNA methylase METTL1 is phosphorylated and inactivated by PKB and RSK in vitro and in cells." in: The EMBO journal, Vol. 24, Issue 9, pp. 1696-705, 2005 (PubMed).