Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody

Antigen: Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H)

Synonyms: RPB8, RPB17, RPABC3, hsRPB8, MGC8248, MGC103049, Polr2h, MGC80152, POLR2H, RGD1561203, MGC140013, rpb8, rpb17, hsrpb8, rpabc3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN311065

Additional Information

Alternative name: POLR2H / RPABC3

Gene ID: POLR2H

UniProt: P52434

Immunogen: The immunogen for anti-POLR2H antibody: synthetic peptide directed towards the N terminal of human POLR2H

Sequence: DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEY VMYGKVYRIE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-POLR2H antibody concentration is 1 mg/ml.

Description: POLR2H is one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-400 AU142999.1 1-400 401-907 BI772069.1 287-793 908-1792 BC008348.1 928-1812 1793-3185 AC099344.4 111461-112853 c

Characteristics: Antigen Size: 150 amino acids

Molecular Weight: 17kDa

Application Details

Application Notes: WB Suggested Anti-POLR2H Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-POLR2H Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).