POLR2H antibody (N-Term)

Catalog No. ABIN629625

Product Details anti-POLR2H Antibody

Target: POLR2H (Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR2H antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POLR2 H antibody was raised against the N terminal of POLR2

Purification: Purified

Immunogen: POLR2 H antibody was raised using the N terminal of POLR2 corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR2H Blocking Peptide, catalog no. 33R-2043, is also available for use as a blocking control in assays to test for specificity of this POLR2H antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR2H

Target: POLR2H (Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H))

Alternative Name: POLR2H (POLR2H Products)

Synonyms: RPABC3 antibody, RPB17 antibody, RPB8 antibody, POLR2H antibody, RGD1561203 antibody, rpb8 antibody, rpb17 antibody, hsrpb8 antibody, rpabc3 antibody, zgc:110289 antibody, RNA polymerase II subunit H antibody, polymerase (RNA) II (DNA directed) polypeptide H antibody, polymerase (RNA) II subunit H L homeolog antibody, polymerase (RNA) II subunit H antibody, info polymerase (RNA) II (DNA directed) polypeptide H antibody, POLR2H antibody, Polr2h antibody, polr2h.L antibody, polr2h antibody

Background: This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways