N-Acetyltransferase 6 (GCN5-Related) (NAT6) antibody

Antigen: N-Acetyltransferase 6 (GCN5-Related) (NAT6)

Synonyms: FUS2, FUS-2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311072

Additional Information

Alternative name: NAT6 / FUS2

Gene ID: NAT6

Immunogen: The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6

Sequence: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPN LTAQAAPRGP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NAT6 antibody concentration is 1 mg/ml.

Description: NAT6 belongs to the acetyltransferase family. It contains 1 N-acetyltransferase domain. NAT6 seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. It may act as a tumor suppressor. Defects in NAT6 are found in non-small cell lung cancer (NSCLC) cell lines.

Characteristics: Antigen Size: 308 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Muzny, Scherer, Kaul et al.: "The DNA sequence, annotation and analysis of human chromosome 3." in: Nature, Vol. 440, Issue 7088, pp. 1194-8, 2006 (PubMed).