Enoyl CoA Hydratase Domain Containing 1 (ECHDC1) antibody

Antigen: Enoyl CoA Hydratase Domain Containing 1 (ECHDC1)

Synonyms: FLJ40827, dJ351K20.2, DKFZp762M1110, MGC129066, DKFZp459A1714

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311091

Additional Information

Alternative name: ECHDC1

Gene ID: ECHDC1

UniProt: Q9NTX5

Immunogen: The immunogen for anti-ECHDC1 antibody: synthetic peptide directed towards the middle region of human ECHDC1

Sequence: GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNA VKSLGTPEDG

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ECHDC1 antibody concentration is 1 mg/ml.

Description: ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.

Characteristics: Antigen Size: 301 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-ECHDC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ECHDC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Publications

Product: Gold, Kirchhoff, Stefanov et al.: "Genome-wide association study provides evidence for a breast cancer risk locus at 6q22.33." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 11, pp. 4340-5, 2008 (PubMed).