Did you know that you can buy products from over 140 different suppliers from us?

N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody

Details for Product No. ABIN311101
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms narg1, narg1l, NARG1L, ga19, nath, tbdn100, MGC135844, 1300019C06Rik, Narg1l
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(6), (3), (3), (1)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311101
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NARG1L
Sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQY SLALDYINAA
Predicted Reactivity Human :100 %,   Bovine :100 %,   Mouse :100 %,   Crab-eating macaque :90 %,  
Characteristics This is a rabbit polyclonal antibody against NARG1L. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name NARG1L
Background NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.
Molecular Weight 50 kDa
Gene ID 79612
NCBI Accession NM_001110798, NP_001104268
UniProt B0QZ59
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 429 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody
anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody (2) anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody (Image 2)
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Validation Images
back to top