Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311111

Transketolase-Like 2 (TKTL2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933401I19Rik, RGD1304767, TKTL2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311111
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2
Sequence SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQ LAVSGVPQRG
Predicted Reactivity African clawed frog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against TKTL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TKTL2
Background The function remains unknown.
Molecular Weight 68kDa
Gene ID 84076
NCBI Accession NP_115512, NM_032136
UniProt Q9H0I9
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TKTL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Transketolase-Like 2 (TKTL2)", type "Antibodies"
Hosts (10), (2)
Reactivities (10), (1), (1), (1), (1), (1)
Applications (10), (4)
Epitopes (5), (2), (2), (1), (1)
Beacon