Transketolase-Like 2 (TKTL2) (C-Term) antibody

Details for Product No. ABIN311111
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933401I19Rik, RGD1304767, TKTL2
Epitope
C-Term
(8), (7), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Human
(15), (1), (1), (1), (1), (1)
Host
Rabbit
(14), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (8), (1)
Pubmed 1 reference available
Catalog no. ABIN311111
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TKTL2
Sequence SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQ LAVSGVPQRG
Predicted Reactivity African clawed frog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Horse : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against TKTL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TKTL2
Background The function remains unknown.
Molecular Weight 68 kDa
Gene ID 84076
NCBI Accession NM_032136, NP_115512
UniProt Q9H0I9
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 626 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transketolase-Like 2 (TKTL2) (C-Term) antibody WB Suggested Anti-TKTL2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (14), (3)
Reactivities (15), (1), (1), (1), (1), (1)
Applications (15), (8), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top