Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1) antibody

Antigen: Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1)

Synonyms: FLJ10883, fd15e12, MGC111953, MGC123165, wu:fd15e12

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311117

Additional Information

Alternative name: PCMTD1

Gene ID: PCMTD1

UniProt: Q96MG8

Immunogen: The immunogen for anti-PCMTD1 antibody: synthetic peptide directed towards the middle region of human PCMTD1

Sequence: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAV RNLQDLARIY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PCMTD1 antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 357 amino acids

Molecular Weight: 41kDa

Application Details

Application Notes: WB Suggested Anti-PCMTD1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PCMTD1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).