Glutathione S-Transferase alpha 5 (GSTa5) (Middle Region) antibody

Details for Product No. ABIN311138
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Yc2
Epitope
Middle Region
(2), (2), (2)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
(6), (4), (1)
Host
Rabbit
(7), (2), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2)
Application
Western Blotting (WB)
(11), (8), (4), (4), (2), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN311138
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GSTA5
Sequence QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNK LSWADIHLVE
Predicted Reactivity Bovine : 100 %, Human : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against GSTA5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GSTA5
Background GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
Molecular Weight 26 kDa
Gene ID 221357
NCBI Accession NM_153699, NP_714543
UniProt Q7RTV2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 222 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glutathione S-Transferase alpha 5 (GSTa5) (Middle Region) antibody WB Suggested Anti-GSTA5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6...." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Hosts (7), (2), (2)
Reactivities (6), (4), (1)
Applications (11), (8), (4), (4), (2), (2), (2), (2)
Conjugates (2)
Epitopes (2), (2), (2)
back to top