Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311138

Glutathione S-Transferase alpha 5 (GSTa5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Yc2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311138
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5
Sequence QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNK LSWADIHLVE
Predicted Reactivity Bovine : 100%, Human : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against GSTA5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GSTA5
Background GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
Molecular Weight 26kDa
Gene ID 221357
NCBI Accession NP_714543, NM_153699
UniProt Q7RTV2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GSTA5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Glutathione S-Transferase alpha 5 (GSTa5)", type "Antibodies"
Hosts (6), (2), (1)
Reactivities (6), (2), (1)
Applications (9), (6), (2), (2), (2), (2), (1), (1)
Conjugates (2)
Epitopes (2), (2), (1)
Beacon