Glutathione S-Transferase alpha 5 (GSTa5) antibody

Antigen: Glutathione S-Transferase alpha 5 (GSTa5)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit, Pig (Porcine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311138

Additional Information

Alternative name: GSTA5

Gene ID: GSTA5

UniProt: Q7RTV2

Immunogen: The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5

Sequence: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNK LSWADIHLVE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GSTA5 antibody concentration is 1 mg/ml.

Description: GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.

Characteristics: Antigen Size: 222 amino acids

Molecular Weight: 26kDa

Application Details

Application Notes: WB Suggested Anti-GSTA5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GSTA5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).