Transmembrane Protein 126B (TMEM126B) antibody

Antigen: Transmembrane Protein 126B (TMEM126B)

Synonyms: HT007, MGC111203

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN311168

Additional Information

Alternative name: TMEM126B

Gene ID: TMEM126B

UniProt: A8K535

Immunogen: The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the middle region of human TMEM126B

Sequence: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKG RVLIHWMTLC

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TMEM126B antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 200 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-TMEM126B Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM126B Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Hu, Han, Song et al.: "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 17, pp. 9543-8, 2000 (PubMed).