Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311171

Chromosome 20 Open Reading Frame 24 (C20ORF24) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIP5, fi26d09, zgc:55393, wu:fi26d09, MGC80227, C20orf24
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311171
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C20orf24 antibody: synthetic peptide directed towards the N terminal of human C20orf24
Sequence MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDE FLDVIYWFRQ
Predicted Reactivity Human : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against C20orf24. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name C20orf24
Background The function remain unknown.
Molecular Weight 15kDa
Gene ID 55969
NCBI Accession NP_061328, NM_018840
UniProt Q9BUV8-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C20orf24 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Chromosome 20 Open Reading Frame 24 (C20ORF24)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12), (12)
Applications (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon