Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 20 Open Reading Frame 24 (C20ORF24) (N-Term) antibody

Details for Product No. ABIN311171
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIP5, fi26d09, zgc:55393, wu:fi26d09, MGC80227, C20orf24
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(13), (12), (12), (12)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311171
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C20orf24
Sequence MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDE FLDVIYWFRQ
Predicted Reactivity Human : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against C20orf24. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name C20orf24
Background The function remain unknown.
Molecular Weight 15 kDa
Gene ID 55969
NCBI Accession NM_018840, NP_061328
UniProt Q9BUV8-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 129 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 20 Open Reading Frame 24 (C20ORF24) (N-Term) antibody WB Suggested Anti-C20orf24 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (14)
Reactivities (13), (12), (12), (12)
Applications (10), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311171
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top