Chromosome 20 Open Reading Frame 24 (C20ORF24) antibody

Antigen: Chromosome 20 Open Reading Frame 24 (C20ORF24)

Synonyms: fi26d09, zgc:55393, wu:fi26d09, MGC80227, C20orf24, RIP5, PNAS-11

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311171

Additional Information

Alternative name: C20orf24 / RIP5

Gene ID: C20orf24

UniProt: Q9BUV8-2

Immunogen: The immunogen for anti-C20orf24 antibody: synthetic peptide directed towards the N terminal of human C20orf24

Sequence: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDE FLDVIYWFRQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-C20orf24 antibody concentration is 1 mg/ml.

Description: The function remain unknown.

Characteristics: Antigen Size: 129 amino acids

Molecular Weight: 15kDa

Application Details

Application Notes: WB Suggested Anti-C20orf24 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C20orf24 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).