Protocadherin gamma Subfamily B, 1 (PCDHGB1) antibody

Antigen: Protocadherin gamma Subfamily B, 1 (PCDHGB1)

Synonyms: MGC119466, MGC119467, MGC119469, PCDH-GAMMA-B1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Rat (Rattus), Mouse (Murine), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311176

Additional Information

Alternative name: PCDHGB1

Gene ID: PCDHGB1

UniProt: Q3SY75

Immunogen: The immunogen for anti-PCDHGB1 antibody: synthetic peptide directed towards the N terminal of human PCDHGB1

Sequence: SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSG TTHIWIRVTD

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PCDHGB1 antibody concentration is 1 mg/ml.

Description: PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.

Characteristics: Antigen Size: 810 amino acids

Molecular Weight: 85kDa

Application Details

Application Notes: WB Suggested Anti-PCDHGB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-PCDHGB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Publications

Product: Wu, Zhang, Cheng et al.: "Comparative DNA sequence analysis of mouse and human protocadherin gene clusters." in: Genome research, Vol. 11, Issue 3, pp. 389-404, 2001 (PubMed).