Protocadherin gamma Subfamily C, 4 (PCDHGC4) antibody

Antigen: Protocadherin gamma Subfamily C, 4 (PCDHGC4)

Synonyms: MGC24978, MGC119489, PCDH-GAMMA-C4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311177

Additional Information

Alternative name: PCDHGC4

Gene ID: PCDHGC4

UniProt: Q9Y5F7

Immunogen: The immunogen for anti-PCDHGC4 antibody: synthetic peptide directed towards the N terminal of human PCDHGC4

Sequence: VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPP RSGTAELRVS

Cross-Reactivity: Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PCDHGC4 antibody concentration is 1 mg/ml.

Description: PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.

Characteristics: Antigen Size: 938 amino acids

Molecular Weight: 98kDa

Application Details

Application Notes: WB Suggested Anti-PCDHGC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-PCDHGC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate

Publications

Product: Wu, Zhang, Cheng et al.: "Comparative DNA sequence analysis of mouse and human protocadherin gene clusters." in: Genome research, Vol. 11, Issue 3, pp. 389-404, 2001 (PubMed).