Did you know that you can buy products from over 140 different suppliers from us?

Yip1 Domain Family, Member 1 (YIPF1) (Middle Region) antibody

Details for Product No. ABIN311179
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DJ167A19.1, FinGER1, C030002N13Rik
Epitope
Middle Region
(9), (8), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
(13)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (8), (7), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311179
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human YIPF1
Sequence HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMW RNSKVMNIVS
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against YIPF1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name YIPF1
Background YIPF1 is a multi-pass membrane protein. It belongs to the YIP1 family. The exact function of YIPF1 remains unknown.
Molecular Weight 34 kDa
Gene ID 54432
NCBI Accession NM_018982, NP_061855
UniProt Q9Y548
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 306 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top