Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311179

Yip1 Domain Family, Member 1 (YIPF1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FinGER1, DJ167A19.1, C030002N13Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311179
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-YIPF1 antibody: synthetic peptide directed towards the middle region of human YIPF1
Sequence HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMW RNSKVMNIVS
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against YIPF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name YIPF1
Background YIPF1 is a multi-pass membrane protein. It belongs to the YIP1 family. The exact function of YIPF1 remains unknown.
Molecular Weight 34kDa
Gene ID 54432
NCBI Accession NP_061855, NM_018982
UniProt Q9Y548
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-YIPF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Yip1 Domain Family, Member 1 (YIPF1)", type "Antibodies"
Hosts (8)
Reactivities (7)
Applications (8), (3), (2), (2)
Epitopes (4), (2), (2), (2), (1)
Beacon