Yip1 Domain Family, Member 1 (YIPF1) antibody

Antigen: Yip1 Domain Family, Member 1 (YIPF1)

Synonyms: FinGER1, DJ167A19.1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN311179

Additional Information

Alternative name: YIPF1

Gene ID: YIPF1

UniProt: Q9Y548

Immunogen: The immunogen for anti-YIPF1 antibody: synthetic peptide directed towards the middle region of human YIPF1

Sequence: HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMW RNSKVMNIVS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-YIPF1 antibody concentration is 1 mg/ml.

Description: YIPF1 is a multi-pass membrane protein. It belongs to the YIP1 family. The exact function of YIPF1 remains unknown.

Characteristics: Antigen Size: 306 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-YIPF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-YIPF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).