Mdm1 Nuclear Protein Homolog (Mouse) (MDM1) antibody

Antigen: Mdm1 Nuclear Protein Homolog (Mouse) (MDM1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN311186

Additional Information

Alternative name: MDM1

Gene ID: MDM1

UniProt: B2RB22

Immunogen: The immunogen for anti-MDM1 antibody: synthetic peptide directed towards the N terminal of human MDM1

Sequence: GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISE SNVVASPEPE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MDM1 antibody concentration is 1 mg/ml.

Description: MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. This gene encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage.

Characteristics: Antigen Size: 222 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-MDM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MDM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).